PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10037450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 205aa    MW: 22616.6 Da    PI: 9.6185
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10037450genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.34e-233681146
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                 k++en+  r+vtfskR+ng++KKA ELS+LC+a+vavi+fs++ k+
  Lus10037450 36 KKVENDPHRHVTFSKRKNGLFKKATELSTLCGAQVAVILFSQHHKV 81
                 6789*************************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.5E-312887IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.2452888IPR002100Transcription factor, MADS-box
CDDcd002651.03E-322996No hitNo description
SuperFamilySSF554552.22E-2629100IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-193050IPR002100Transcription factor, MADS-box
PfamPF003191.3E-223783IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-195065IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-196586IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MTSGARTTAA GKKSKPEASA AAVKKPSKGR QKIEIKKVEN DPHRHVTFSK RKNGLFKKAT  60
ELSTLCGAQV AVILFSQHHK VFSCGRPDVD SVLHRYDLHR LHENQIPNLT LNNDVNHGDC  120
KGSFGIGSES AVQEQEYVKA VERLEEGKRY VAAMAAFGGD PAAAGSWWEN WAVEKMEEKD  180
EVQSYKESLV ELREKVSARL GSIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A3e-172996168Myocyte-specific enhancer factor 2A
3mu6_B3e-172996168Myocyte-specific enhancer factor 2A
3mu6_C3e-172996168Myocyte-specific enhancer factor 2A
3mu6_D3e-172996168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002323594.27e-48hypothetical protein POPTR_0016s12640g
TrEMBLB9IGB88e-48B9IGB8_POPTR; Uncharacterized protein
STRINGPOPTR_0016s12640.12e-47(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-25AGAMOUS-like 62